| Edit |   |
| Antigenic Specificity | COBL-Like 1 (COBLL1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of COBLL1 has not been widely studied, and is yet to be fully elucidated. |
| Immunogen | Cobl-Like 1 antibody was raised using the middle region of COBLL1 corresponding to a region with amino acids QAKPSSFFLQMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLP |
| Other Names | DKFZp468N1516|1810047P18Rik|Coblr1|D430044D16Rik|COBLR1 |
| Gene, Accession # | Gene ID: 22837 |
| Catalog # | ABIN632504 |
| Price | |
| Order / More Info | COBL-Like 1 (COBLL1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |