| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Isocitrate Dehydrogenase 3 (NAD+) alpha (IDH3A) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat, dog |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. |
| Immunogen | IDH3 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK |
| Other Names | idh3a|MGC76128|IDH3A|zgc:56380|zgc:85631|BG1|1110003P10Rik|1500012E04Rik|AA407078|AI316514 |
| Gene, Accession # | Gene ID: 3419,479066,67834,114096 |
| Catalog # | ABIN629675 |
| Price | |
| Order / More Info | Isocitrate Dehydrogenase 3 (NAD+) alpha (IDH3A) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|