| Edit |   |
| Antigenic Specificity | Choline Kinase alpha (CHKA) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine. |
| Immunogen | CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI |
| Other Names | im:7143625|wu:fd46h01|si:dkey-12e7.3|CHKA|chkb|ATCK1|CHOLINE KINASE|CK|F14O23.8|F14O23_8|choline kinase 1|CHK|CKI|EK|CK/EK-alpha|Chetk-alpha|Chk|ChoK|EtnK-alpha|CK-R |
| Gene, Accession # | Gene ID: 1119,12660,29194 |
| Catalog # | ABIN632201 |
| Price | |
| Order / More Info | Choline Kinase alpha (CHKA) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |