| Edit |   |
|---|
| Antigenic Specificity | Adenylate Kinase 1/AK1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat (predicted: bovine, canine, monkey, rabbit) |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband? antibody for Adenylate kinase isoenzyme 1(AK1) detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human AK1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH), different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids. |
|---|
| Other Names | Adenylate kinase isoenzyme 1 ;AK 1 ;2.7.4.3 ;2.7.4.6 ;ATP-AMP transphosphorylase 1 ;ATP:AMP phosphotransferase ;Adenylate monophosphate kinase ;Myokinase ;AK1 ; |
|---|
| Gene, Accession # | AK1, UniProt: P00568 |
|---|
| Catalog # | PB10033 |
|---|
| Price | |
|---|
| Order / More Info | Adenylate Kinase 1/AK1 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|