| Edit |   |
| Antigenic Specificity | EF-Hand Calcium Binding Domain 4B (EFCAB4B) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | EFCAB4B is a Ca(2+)-binding protein that plays a key role in store-operated Ca(2+) entry (SOCE) in T-cells by regulating CRAC channel activation. Acts as a cytoplasmic calcium-sensor that facilitates the clustering of ORAI1 and STIM1 at the junctional regions between the plasma membrane and the endoplasmic reticulum upon low Ca(2+) concentration. It thereby regulates CRAC channel activation, including translocation and clustering of ORAI1 and STIM1. Upon increase of cytoplasmic Ca(2+) resulting from opening of CRAC channels, dissociates from ORAI1 and STIM1, thereby destabilizing the ORAI1-STIM1 complex. |
| Immunogen | EFCAB4 B antibody was raised using the N terminal of EFCAB4 corresponding to a region with amino acids ARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQ |
| Other Names | CRACR2A|Gm1073|Gm462 |
| Gene, Accession # | Gene ID: 84766 |
| Catalog # | ABIN632347 |
| Price | |
| Order / More Info | EF-Hand Calcium Binding Domain 4B (EFCAB4B) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |