| Edit |   |
| Antigenic Specificity | EF-Hand Domain Family, Member A2 (EFHA2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of EFHA protein is not widely studied, and is yet to be elucidated fully. |
| Immunogen | EFHA2 antibody was raised using the N terminal of EFHA2 corresponding to a region with amino acids AAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIP |
| Other Names | EFHA2|2900075B16Rik|Efha2 |
| Gene, Accession # | Gene ID: 286097 |
| Catalog # | ABIN632842 |
| Price | |
| Order / More Info | EF-Hand Domain Family, Member A2 (EFHA2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |