If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Rabbit IgG polyclonal Picoband? antibody for MRP2/ABCC2 detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Multidrug resistance-associated protein 2 (MRP2), also called canalicular multispecific organic anion transporter 1 (cMOAT) or ATP-binding cassette sub-family C member 2 (ABCC2), is a protein that in humans is encoded by the ABCC2 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia.
Immunogen
A synthetic peptide corresponding to a sequence of human MRP2/ABCC2(AIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD).
Other Names
Canalicular multispecific organic anion transporter 1; ATP-binding cassette sub-family C member 2; Canalicular multidrug resistance protein; Multidrug resistance-associated protein 2; ABCC2; CMOAT; CMOAT1; CMRP; MRP2