| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | MRP1/ABCC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | unconjugated |
| Size | 100ug (sample available) |
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband? antibody for Multidrug resistance-associated protein 1(ABCC1) detection. Tested with WB in Human. No cross reactivity with other proteins. Multidrug resistance-associated protein 1 (MRP1) is a protein that in humans is encoded by the ABCC1 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MRP1 (1493-1528aa DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids. |
| Other Names | Multidrug resistance-associated protein 1;ATP-binding cassette sub-family C member 1;Leukotriene C(4) transporter;LTC4 transporter;ABCC1;MRP, MRP1; |
| Gene, Accession # | ABCC1, UniProt: P33527 |
| Catalog # | A00872 |
| Price | |
| Order / More Info | MRP1/ABCC1 Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|