| Edit |   |
| Antigenic Specificity | Asparagine-Linked Glycosylation 1, beta-1,4-Mannosyltransferase Homolog (S. Cerevisiae) (ALG1) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K). |
| Immunogen | ALG1 antibody was raised using the N terminal of ALG1 corresponding to a region with amino acids VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG |
| Other Names | zgc:66221|wu:fi34b12|CDG1K|HMAT1|HMT-1|HMT1|MT-1|Mat-1|hMat-1 |
| Gene, Accession # | Gene ID: 56052 |
| Catalog # | ABIN635919 |
| Price | |
| Order / More Info | Asparagine-Linked Glycosylation 1, beta-1,4-Mannosyltransferase Homolog (S. Cerevisiae) (ALG1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |