| Edit |   |
| Antigenic Specificity | Asparagine-Linked Glycosylation 1 Homolog Pseudogene (LOC339879) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of LOC339879 protein is not widely studied, and is yet to be elucidated fully. |
| Immunogen | LOC339879 antibody was raised using the C terminal of LOC339879 corresponding to a region with amino acids HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQL |
| Other Names | n/a |
| Gene, Accession # | n/a |
| Catalog # | ABIN629659 |
| Price | |
| Order / More Info | Asparagine-Linked Glycosylation 1 Homolog Pseudogene (LOC339879) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |