| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | DHX38 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DHX38 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DHX38. This antibody reacts with human. The DHX38 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human DHX38 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IPVKDATSDLAIIARKGSQTVRKHREQKERKKAQHKHWELAGTKLGDIMGVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSEASSEFAKKKSIL |
| Other Names | ATP-dependent RNA helicase DHX38, DDX38pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38, DEAH (Asp-Glu-Ala-His) box polypeptide 38, DEAH box protein 38, EC 3.6.1, EC 3.6.4.13, KIAA0224pre-mRNA splicing factor ATP-dependent RNA helicase PRP16, PRP16 homolog of S.cerevisiae, PRP16hPrp16, PRPF16 |
| Gene, Accession # | DHX38, Gene ID: 9785 |
| Catalog # | NBP2-58971 |
| Price | |
| Order / More Info | DHX38 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|