| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Reduced Folate Carrier/SLC19A1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Reduced Folate Carrier/SLC19A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Reduced Folate Carrier/SLC19A1. This antibody reacts with human. The Reduced Folate Carrier/SLC19A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to SLC19A1(solute carrier family 19 (folate transporter), member 1) The peptide sequence was selected from the N terminal of SLC19A1. Peptide sequence MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP. |
| Other Names | CHMD, FLOT1, folate transporter 1, FOLThuman reduced folate carrier (RFC)10Intestinal folate carrier 1, IFC1, IFC-1, Placental folate transporter, Reduced folate carrier protein, REFC, RFC, RFC1, solute carrier family 19 (folate transporter), member 1, Solute carrier family 19 member 1 |
| Gene, Accession # | SLC19A1, Gene ID: 6573, Accession: P41440, SwissProt: P41440 |
| Catalog # | NBP1-59904 |
| Price | |
| Order / More Info | Reduced Folate Carrier/SLC19A1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|