| Edit |   |
|---|
| Antigenic Specificity | TBC1D13 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TBC1D13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TBC1D13. This antibody reacts with human. The TBC1D13 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TBC1D13(TBC1 domain family, member 13) The peptide sequence was selected from the middle region of TBC1D13. Peptide sequence FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS. |
|---|
| Other Names | FLJ10743, TBC1 domain family member 13, TBC1 domain family, member 13 |
|---|
| Gene, Accession # | TBC1D13, Gene ID: 54662, Accession: Q5T270, SwissProt: Q5T270 |
|---|
| Catalog # | NBP1-56897-20ul |
|---|
| Price | |
|---|
| Order / More Info | TBC1D13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|