| Edit |   |
| Antigenic Specificity | Lactamase, beta (LACTB) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins. |
| Immunogen | Beta Lactamase antibody was raised using the C terminal of LACTB corresponding to a region with amino acids TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL |
| Other Names | BA3500|BA2507|PSPTO2834|PSPTO3594|G24|MRPL56|LACT-1|Lact1|Mrpl56|zgc:110419 |
| Gene, Accession # | Gene ID: 114294,80907,300803 |
| Catalog # | ABIN631015 |
| Price | |
| Order / More Info | Lactamase, beta (LACTB) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |