| Edit |   |
| Antigenic Specificity | EH-Domain Containing 4 (EHD4) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway. |
| Immunogen | EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA |
| Other Names | EHD4|past4|PAST4|2210022F10Rik|AI197390|AI846352|AV006278|Past2 |
| Gene, Accession # | Gene ID: 30844,98878,192204 |
| Catalog # | ABIN631254 |
| Price | |
| Order / More Info | EH-Domain Containing 4 (EHD4) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |