| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | PCGF5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PCGF5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCGF5. This antibody reacts with human. The PCGF5 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PCGF5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TCIVQHFEDSNDCPRCGNQVHETNPLEMLRLDNTLEEIIFKLVPGLREQELERESEFWKKNKPQENGQDDTSKAD |
| Other Names | MGC16202, polycomb group ring finger 5, polycomb group RING finger protein 5, ring finger protein (C3HC4 type) 159, RING finger protein 159, RNF159 |
| Gene, Accession # | PCGF5, Gene ID: 84333 |
| Catalog # | NBP1-82745 |
| Price | |
| Order / More Info | PCGF5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|