Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The CtBP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CtBP1. This antibody reacts with human, mouse, rat. The CtBP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human, mouse, rat CtBP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL
Other Names
BARS, brefeldin A-ribosylated substrate, CTBP, CtBP1, C-terminal binding protein 1, C-terminal-binding protein 1, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.158, MGC104684