| Edit |   |
|---|
| Antigenic Specificity | TBC1D26 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TBC1D26 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TBC1D26. This antibody reacts with human. The TBC1D26 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MGC51025 The peptide sequence was selected from the middle region of MGC51025. Peptide sequence RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKH. |
|---|
| Other Names | MGC51025, TBC1 domain family member 26, TBC1 domain family, member 26 |
|---|
| Gene, Accession # | TBC1D26, Gene ID: 353149, Accession: Q86UD7, SwissProt: Q86UD7 |
|---|
| Catalog # | NBP1-57658-20ul |
|---|
| Price | |
|---|
| Order / More Info | TBC1D26 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|