| Edit |   |
|---|
| Antigenic Specificity | SPATA9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SPATA9 antibody. Specificity: SPATA9 antibody was raised against the N terminal of SPATA9 |
|---|
| Immunogen | SPATA9 antibody was raised using the N terminal of SPATA9 corresponding to a region with amino acids FKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISR |
|---|
| Other Names | SPATA9 protein; Spermatogenesis-associated protein 9; spermatogenesis-associated protein 9; spermatogenesis associated 9; Testis development protein NYD-SP16, SPATA9; SPATA9; NYD-SP16 |
|---|
| Gene, Accession # | SPATA9, Gene ID: 83890, NCBI: AAH32832.1 |
|---|
| Catalog # | MBS5300341 |
|---|
| Price | |
|---|
| Order / More Info | SPATA9 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|