| Edit |   |
| Antigenic Specificity | Calmegin (CLGN) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneis and infertility. |
| Immunogen | Calmegin antibody was raised using the N terminal of CLGN corresponding to a region with amino acids YKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL |
| Other Names | canx|fj49d10|wu:fj24b04|wu:fj49d10|zgc:153946|CLGN|clgn|clnx|cnx|4930459O04Rik|AI528775|Cln |
| Gene, Accession # | Gene ID: 1047 |
| Catalog # | ABIN630467 |
| Price | |
| Order / More Info | Calmegin (CLGN) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |