Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The TRPA1 Antibody (6G8) from Novus Biologicals is a mouse monoclonal antibody to TRPA1. This antibody reacts with human, guinea pig. The TRPA1 Antibody (6G8) has been validated for the following applications: Western Blot, ELISA.
Immunogen
TRPA1 (NP_015628 1033 a.a. - 1117 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL
Other Names
ANKTM1ankyrin-like with transmembrane domains 1, Ankyrin-like with transmembrane domains protein 1, Transformation-sensitive protein p120, transient receptor potential cation channel subfamily A member 1, transient receptor potential cation channel, subfamily A, member 1