Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The TROVE2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TROVE2. This antibody reacts with human. The TROVE2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Immunogen
Synthetic peptides corresponding to TROVE2 (TROVE domain family, member 2) The peptide sequence was selected from the N terminal of TROVE2. Peptide sequence QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR.
Other Names
60 kDa ribonucleoprotein Ro, 60 kDa Ro protein, 60 kDa SS-A/Ro ribonucleoprotein, Ro 60 kDa autoantigen, RO60gastric cancer multi-drug resistance protein, RORNP, Sjoegren syndrome antigen A2, Sjoegren syndrome type A antigen, Sjogren syndrome antigen A2 (60kDa, ribonucleoprotein autoantigen SS-A/Ro), SS-A, SSA2Sjogren syndrome antigen A2 (60kD, ribonucleoprotein autoantigen SS-A/Ro), TROVE domain family member 2, TROVE domain family, member 2