| Edit |   |
| Antigenic Specificity | Carnitine O-Octanoyltransferase (CROT) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Carnitine octanoyltransferase is a carnitine acyltransferase that catalyzes the reversible transfer of fatty acyl groups between CoA and carnitine. This provides a crucial step in the transport of medium- and long-chain acyl-CoA out of the mammalian peroxisome to the cytosol and mitochondria. |
| Immunogen | CROT antibody was raised using the N terminal of CROT corresponding to a region with amino acids MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKK |
| Other Names | CROT|cot|zgc:110643|COT|1200003H03Rik |
| Gene, Accession # | Gene ID: 54677,74114 |
| Catalog # | ABIN629682 |
| Price | |
| Order / More Info | Carnitine O-Octanoyltransferase (CROT) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |