| Edit |   |
| Antigenic Specificity | Lysozyme-Like 6 (LYZL6) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | LYZL6 belongs to the glycosyl hydrolase 22 family. The exact function of LYZL6 remains unknown. |
| Immunogen | LYZL6 antibody was raised using the N terminal of LYZL6 corresponding to a region with amino acids MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL |
| Other Names | LYC1|PRO1485|TKAL754|UNQ754|1700023H08Rik|Lyc1|RGD1306968 |
| Gene, Accession # | Gene ID: 57151 |
| Catalog # | ABIN634036 |
| Price | |
| Order / More Info | Lysozyme-Like 6 (LYZL6) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |