| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | NBR1 |
| Clone | 6B11 |
| Host Species | Mouse |
| Reactive Species | human, mouse |
| Isotype | IgG1 kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NBR1 Antibody (6B11) from Novus Biologicals is a mouse monoclonal antibody to NBR1. This antibody reacts with human, mouse. The NBR1 Antibody (6B11) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | NBR1 (NP_005890, 2 a.a. - 96 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV |
| Other Names | Cell migration-inducing gene 19 protein, FLJ98272, KIAA0049CA125, M17S2FLJ55359,1A1-3B, Membrane component chromosome 17 surface marker 2,1A13B, membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigenCA125), migration-inducing protein 19, neighbor of BRCA1 gene 1, Neighbor of BRCA1 gene 1 protein, next to BRCA1 gene 1 protein, Protein 1A1-3B |
| Gene, Accession # | NBR1, Gene ID: 4077, Accession: NP_005890, SwissProt: NP_005890 |
| Catalog # | H00004077-M01 |
| Price | |
| Order / More Info | NBR1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 19822672, 20937771, 23212369, 23239026, 23295856, 23804102, 24664425, 24879152, 25327288, 25358256 |
| 產(chǎn)品資料 |
|
|