| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | NBR1 |
| Clone | 5C3 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | ascites, no preservative |
| Size | 100 ug |
| Concentration | n/a |
| Applications | Western Blot, ELISA, RNA Inhibition. Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NBR1 Antibody (5C3) from Novus Biologicals is a mouse monoclonal antibody to NBR1. This antibody reacts with human. The NBR1 Antibody (5C3) has been validated for the following applications: Western Blot, ELISA, RNA Inhibition. |
| Immunogen | NBR1 (NP_005890, 2 a.a. - 96 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV |
| Other Names | Cell migration-inducing gene 19 protein, FLJ98272, KIAA0049CA125, M17S2FLJ55359,1A1-3B, Membrane component chromosome 17 surface marker 2,1A13B, membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigenCA125), migration-inducing protein 19, neighbor of BRCA1 gene 1, Neighbor of BRCA1 gene 1 protein, next to BRCA1 gene 1 protein, Protein 1A1-3B |
| Gene, Accession # | NBR1, Gene ID: 4077, SwissProt: NP_005890 |
| Catalog # | H00004077-M05-100ug |
| Price | |
| Order / More Info | NBR1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 25007327 |
| 產(chǎn)品資料 |
|
|