| Edit |   |
| Antigenic Specificity | Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons. |
| Immunogen | LRRTM1 antibody was raised using the middle region of LRRTM1 corresponding to a region with amino acids RIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAH |
| Other Names | im:6904481|4632401D06Rik|AW125451 |
| Gene, Accession # | Gene ID: 347730,74342,679668 |
| Catalog # | ABIN635752 |
| Price | |
| Order / More Info | Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |