| Edit |   |
| Antigenic Specificity | Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | LRRC51 encodes two different proteins. One is a leucine-rich transmembrane protein of unknown function while the other is an O-methyltransferase. Defects in the O-methyltransferase protein can cause nonsyndromic deafness. Several transcript variants encoding different isoforms of each protein have been found for this gene, along with a transcript that is not thought to be protein-coding. |
| Immunogen | LRRC51 antibody was raised using the N terminal of LRRC51 corresponding to a region with amino acids MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL |
| Other Names | 1700008D07Rik|Lrtomt|RGD1565856|DFNB63|LRRC51|RGD1561509|Comt2|F930017I19Rik |
| Gene, Accession # | Gene ID: 220074 |
| Catalog # | ABIN632367 |
| Price | |
| Order / More Info | Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |